PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29805.m001504
Common NameLOC8283841, RCOM_0819900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 474aa    MW: 51999.3 Da    PI: 8.4021
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29805.m001504genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.51.2e-32193249360
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  29805.m001504 193 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSL-DGRIAEIVYKGEHNHSK 249
                    9***************************************.***************85 PP

2WRKY992.9e-31393450259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     Dg++WrKYGqK+vkg+++prsYYrCt  +C+v+k ver ++dp ++++tYeg+Hnhe
  29805.m001504 393 GDGFRWRKYGQKVVKGNPYPRSYYRCTGLKCNVRKYVERVSDDPGAFITTYEGKHNHE 450
                    6********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-29186250IPR003657WRKY domain
SuperFamilySSF1182901.18E-25190250IPR003657WRKY domain
SMARTSM007744.8E-37191249IPR003657WRKY domain
PfamPF031062.7E-25193247IPR003657WRKY domain
PROSITE profilePS5081124.053193250IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-32378452IPR003657WRKY domain
SuperFamilySSF1182904.45E-28386452IPR003657WRKY domain
PROSITE profilePS5081132.868387452IPR003657WRKY domain
SMARTSM007747.0E-36392451IPR003657WRKY domain
PfamPF031062.1E-24394450IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MEINEAERVV IAKPVASRPT CSNFRSFSEL LAGAINGSPP NVCSETTVAA IRPKTVRFKP  60
MINCAPAVSI SSQADLSGTA LCNSSDKVLK ADCKPTVIYK PQAKLVSKAT VSLLANMGNF  120
NDNYQQQRLI SVETPVQNPN QEQHNFSSHL HQNFPSQAQT DQTTELSRLS SQNQEDDLKS  180
LSAAANVDRP SYDGYNWRKY GQKQVKGSEY PRSYYKCTHP NCPVKKKVER SLDGRIAEIV  240
YKGEHNHSKP QPLKRNSSGT QGPGPVCDGN NQDTNNPLWN NSVNERNEGS EGRVENQNEI  300
GLPAHSTYQT TAPHTHDPAR NGSINAGAVT SDNSCGLSGE CEEGSKGLEG GEDEPRSKRR  360
KSDNQSNEAG ISAEGRQEPH LVVQSSTETE IVGDGFRWRK YGQKVVKGNP YPRSYYRCTG  420
LKCNVRKYVE RVSDDPGAFI TTYEGKHNHE MPLRGSNSAA QESNSQAPSG RSKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-30193452877Probable WRKY transcription factor 4
2lex_A5e-30193452877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525200.10.0PREDICTED: WRKY transcription factor 44
TrEMBLB9SGT10.0B9SGT1_RICCO; Putative uncharacterized protein
STRINGPOPTR_0006s13550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67903450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-119WRKY family protein